PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0057ss02130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 664aa    MW: 74826.3 Da    PI: 6.1336
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0057ss02130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.82.8e-24213266155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Vang0057ss02130.1 213 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 266
                        68*******************.9*******************************8 PP

2Response_reg66.99.2e-23241411109
                        EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHH.HHHT......TTSEEE.EEESTTT CS
       Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkei.reee......pklpii.vvtahge 82 
                        vl+vdD+p+ +++l+++l+k +y ev+++  ++ al+ll+e++  +D+++ D++mp+mdG++ll++   e +      ++l++  v++  ge
  Vang0057ss02130.1  24 VLVVDDDPTWLKILEKMLKKCNY-EVTTCCLARHALNLLRERKdgYDIVISDVNMPDMDGFKLLEHVgLEMDlpvishHTLQCCsVMSVDGE 114
                        89*********************.***************999999**********************777667676655555443788**** PP

                        HHHHHHHHHTTESEEEESS--HHHHHH CS
       Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                         + + + ++ Ga d+l Kp+ ++el++
  Vang0057ss02130.1 115 TSRVMKGVQHGACDYLLKPIRMKELRN 141
                        ************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.56E-3021161IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.7E-4021165No hitNo description
SMARTSM004484.9E-2622143IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011035.60923147IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-1924142IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.27E-2625147No hitNo description
SuperFamilySSF466891.61E-16211268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-27211270IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-21213266IPR006447Myb domain, plants
PfamPF002492.1E-7215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
LSLSKMDNGC FSSPRRDFPA GLRVLVVDDD PTWLKILEKM LKKCNYEVTT CCLARHALNL  60
LRERKDGYDI VISDVNMPDM DGFKLLEHVG LEMDLPVISH HTLQCCSVMS VDGETSRVMK  120
GVQHGACDYL LKPIRMKELR NIWQHVFRKR IHEAKEFESF ESFESIHLMR NGSELSDEGN  180
LFAVEDVTST KKRKDADNKH DDKECMDPSS AKKARVVWSV DLHQKFVKAV NQIGFDKVGP  240
KKILDLMNVP WLTRENVASH LQKYRLYLIR IQKENDRRSS SSGMKHSDFP SKDLGSFGFQ  300
NPVNKQQNDV STDSYNYSDG SLHLPTVENK NYEGDKGSVS QFTIAKKGRP LTGNVTDSNM  360
RESSRVGLNQ PFAQSEGNHA VFDCSLPTQY SWTEVPNMQL KEEHKSLVHL EDSFNQMPLH  420
GKQHHIQVDQ SQSVASISSA PSITEEEVPA CIEAKPLFSD FKNDRSSSVN SIGNAVDTFP  480
IQPGSLAMNA QSLEPISTTN SGLKAHGYNN LSCISDVEIY QRNLLLGGEA ASAPLDEDLH  540
FQWLQGECYN MNFGLQNIGM SEYYDPGLIA EAPSHLYDSA DYSVIDQGLA ENSEPRASIT  600
GTTLKRLVYK NGFRTKQCWT KKLKVNFEQY KGGFDEFPKL LSWTVLELEL AFLTSFGDRD  660
SVGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-17209271163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520235.10.0PREDICTED: two-component response regulator ARR11-like isoform X1
TrEMBLA0A0L9UAK30.0A0A0L9UAK3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S1710.0A0A0S3S171_PHAAN; Uncharacterized protein
STRINGGLYMA11G37480.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-120response regulator 11